ZNF445 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324397
Artikelname: ZNF445 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324397
Hersteller Artikelnummer: orb324397
Alternativnummer: BYT-ORB324397-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF445
Konjugation: Unconjugated
Alternative Synonym: anti MGC126535 antibody, anti ZKSCAN15 antibody, anti ZNF168 antibody
Rabbit polyclonal antibody to ZNF445
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 119kDa
NCBI: 852466
UniProt: P59923
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: NVEPKILTGEKRFWCQECGKTFTRKRTLLDHKGIHSGEKRYKCNLCGKSY
Target-Kategorie: ZNF445