MYEF2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324399
Artikelname: MYEF2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324399
Hersteller Artikelnummer: orb324399
Alternativnummer: BYT-ORB324399-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYEF2
Konjugation: Unconjugated
Alternative Synonym: anti FLJ11213 antibody, anti HsT18564 antibody, anti KIAA1341 antibody, anti MEF-2 antibody, anti MGC87325 antibody, anti MST156 antibody, anti MSTP156 antibody
Rabbit polyclonal antibody to MYEF2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 64kDa
NCBI: 057216
UniProt: Q9P2K5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEKSTGSKKANRFHPYS
Target-Kategorie: MYEF2