OR13C5 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324403
Artikelname: OR13C5 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324403
Hersteller Artikelnummer: orb324403
Alternativnummer: BYT-ORB324403-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OR13C5
Konjugation: Unconjugated
Alternative Synonym: anti OR9-11 antibody
Rabbit polyclonal antibody to OR13C5
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 36kDa
NCBI: 001004482
UniProt: Q8NGT0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: CYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAFD
Target-Kategorie: OR13C5