Zfp580 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324404
Artikelname: Zfp580 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324404
Hersteller Artikelnummer: orb324404
Alternativnummer: BYT-ORB324404-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: anti 1500015O20Rik antibody, anti AI838225 antibody, anti Znf580 antibody
Rabbit polyclonal antibody to Zfp580
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 19 kDa
NCBI: 081176
UniProt: Q9DB38
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ANGVPYTYTVQLEEEPRGPPQREATPGEPGPRKGYSCPECARVFASPLRL
Target-Kategorie: Zfp580