ZNF618 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324408
Artikelname: ZNF618 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324408
Hersteller Artikelnummer: orb324408
Alternativnummer: BYT-ORB324408-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZN618
Konjugation: Unconjugated
Alternative Synonym: anti ZNF618 antibody, anti KIAA1952 antibody, anti antibody
Rabbit polyclonal antibody to ZN618
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 104kDa
UniProt: Q5T7W0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: TLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN
Target-Kategorie: ZNF618