SKIIP Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324413
| Artikelname: |
SKIIP Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324413 |
| Hersteller Artikelnummer: |
orb324413 |
| Alternativnummer: |
BYT-ORB324413-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SKIIP |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Bx42 antibody, anti SKIP antibody, anti Prp45 antibody, anti SKIIP antibody, anti PRPF45 antibody, anti NCOA-62 antibody |
| Rabbit polyclonal antibody to SNW1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
61kDa |
| NCBI: |
036377 |
| UniProt: |
Q13573 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE |
| Target-Kategorie: |
SNW1 |
