POU1F1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324414
| Artikelname: |
POU1F1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324414 |
| Hersteller Artikelnummer: |
orb324414 |
| Alternativnummer: |
BYT-ORB324414-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human POU1F1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti GHF-1 antibody, anti PIT1 antibody, anti Pit-1 antibody, anti Pit-1 beta antibody, anti CPHD1 antibody, anti POU1F1a antibody |
| Rabbit polyclonal antibody to POU1F1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
33kDa |
| NCBI: |
000297 |
| UniProt: |
P28069 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: KRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNR |
| Target-Kategorie: |
POU1F1 |
