NEUROD4 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324419
Artikelname: NEUROD4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324419
Hersteller Artikelnummer: orb324419
Alternativnummer: BYT-ORB324419-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NEUROD4
Konjugation: Unconjugated
Alternative Synonym: anti ATH-3 antibody, anti Atoh3 antibody, anti MATH-3 antibody, anti ATH3 antibody, anti bHLHa4 antibody
Rabbit polyclonal antibody to NEUROD4
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 37kDa
NCBI: 067014
UniProt: B2RAC9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GHMETHLLHLKPQVFKSLGESSFGSHLPDCSTPPYEGPLTPPLSISGNFS
Target-Kategorie: NEUROD4