DKFZP761C169 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324437
| Artikelname: |
DKFZP761C169 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324437 |
| Hersteller Artikelnummer: |
orb324437 |
| Alternativnummer: |
BYT-ORB324437-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human DKFZP761C169 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti GPBP antibody, anti SSH6 antibody, anti VASCULIN antibody, anti DKFZP761C169 antibody |
| Rabbit polyclonal antibody to GPBP1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
52kDa |
| NCBI: |
075064 |
| UniProt: |
Q86WP2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP |
| Target-Kategorie: |
GPBP1 |
