ZNF537 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324443
Artikelname: ZNF537 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324443
Hersteller Artikelnummer: orb324443
Alternativnummer: BYT-ORB324443-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF537
Konjugation: Unconjugated
Alternative Synonym: anti TSH3 antibody, anti ZNF537 antibody
Rabbit polyclonal antibody to TSHZ3
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 98kDa
NCBI: 065907
UniProt: Q9H0G6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LNVEVKKEVDKEKAVTDEKPKQKDKPGEEEEKCDISSKYHYLTENDLEES
Target-Kategorie: TSHZ3