TBC1D2B Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324446
Artikelname: TBC1D2B Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324446
Hersteller Artikelnummer: orb324446
Alternativnummer: BYT-ORB324446-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBC1D2B
Konjugation: Unconjugated
Rabbit polyclonal antibody to TBC1D2B
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 92kDa
NCBI: 055894
UniProt: Q9UPU7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: KYSSLEAKLCQIESKYLILLQEMKTPVCSEDQGPTREVIAQLLEDALQVE
Target-Kategorie: TBC1D2B