ARID4A Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324451
Artikelname: ARID4A Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324451
Hersteller Artikelnummer: orb324451
Alternativnummer: BYT-ORB324451-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARID4A
Konjugation: Unconjugated
Alternative Synonym: anti RBP1 antibody, anti RBBP1 antibody, anti RBP-1 antibody, anti RBBP-1 antibody
Rabbit polyclonal antibody to ARID4A
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 143kDa
NCBI: 002883
UniProt: P29374
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: NSSKCTPVKHLNVSKPQKLARSPARISPHIKDGEKDKHREKHPNSSPRTY
Target-Kategorie: ARID4A