HS3ST1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324452
| Artikelname: |
HS3ST1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324452 |
| Hersteller Artikelnummer: |
orb324452 |
| Alternativnummer: |
BYT-ORB324452-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human HS3ST1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti 3OST antibody, anti 3OST1 antibody |
| Rabbit polyclonal antibody to HS3ST1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
36 kDa |
| NCBI: |
005105 |
| UniProt: |
O14792 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV |
| Target-Kategorie: |
HS3ST1 |
