ARFIP2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324455
| Artikelname: |
ARFIP2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324455 |
| Hersteller Artikelnummer: |
orb324455 |
| Alternativnummer: |
BYT-ORB324455-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARFP2 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti ARFIP2 antibody, anti POR1 antibody, anti antibody |
| Rabbit polyclonal antibody to ARFP2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
37kDa |
| NCBI: |
005252897 |
| UniProt: |
P53365 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIK |
| Target-Kategorie: |
ARFIP2 |
