MYNN Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324458
Artikelname: MYNN Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324458
Hersteller Artikelnummer: orb324458
Alternativnummer: BYT-ORB324458-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYNN
Konjugation: Unconjugated
Alternative Synonym: anti OSZF antibody, anti SBBIZ1 antibody, anti ZBTB31 antibody, anti ZNF902 antibody
Rabbit polyclonal antibody to MYNN
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 69kDa
NCBI: 061127
UniProt: Q9NPC7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: KSPYEAENSGEELDQRYSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPY
Target-Kategorie: MYNN