GATAD1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324463
| Artikelname: |
GATAD1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324463 |
| Hersteller Artikelnummer: |
orb324463 |
| Alternativnummer: |
BYT-ORB324463-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human GATAD1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti FLJ22489 antibody, anti FLJ40695 antibody, anti ODAG antibody, anti RG083M05.2 antibody |
| Rabbit polyclonal antibody to GATAD1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
29kDa |
| NCBI: |
066990 |
| UniProt: |
Q8WUU5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: EKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEY |
| Target-Kategorie: |
GATAD1 |
