CCT8L2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324596
| Artikelname: |
CCT8L2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324596 |
| Hersteller Artikelnummer: |
orb324596 |
| Alternativnummer: |
BYT-ORB324596-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human CCT8L2 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti CESK1 antibody, anti MGC118839 antibody, anti MGC118840 antibody |
| Rabbit polyclonal antibody to CCT8L2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
59kDa |
| NCBI: |
055221 |
| UniProt: |
Q96SF2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: AGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLSEVLDTPLLPR |
| Target-Kategorie: |
CCT8L2 |
![]()
|
WB Suggested Anti-CCT8L2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate. |
