ZNF177 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324617
Artikelname: ZNF177 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324617
Hersteller Artikelnummer: orb324617
Alternativnummer: BYT-ORB324617-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZN177
Konjugation: Unconjugated
Alternative Synonym: anti ZNF177 antibody, anti antibody
Rabbit polyclonal antibody to ZN177
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 35kDa
NCBI: 003442
UniProt: Q13360
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQN
Target-Kategorie: ZNF177
Sample Type: Stomach Tumor lysates, Antibody Dilution: 1.0 ug/mL.