LOC115648 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324630
Artikelname: LOC115648 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324630
Hersteller Artikelnummer: orb324630
Alternativnummer: BYT-ORB324630-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC115648
Konjugation: Unconjugated
Rabbit polyclonal antibody to LOC115648
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 12kDa
NCBI: 663299
UniProt: Q9BR99
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: AGIAVSKPDLVTCLEQGKDPWNMKGHSTVVKPPVETGFHRFSQDGLYLLT
Target-Kategorie: LOC115648
WB Suggested Anti-LOC115648 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart.