HELB Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324648
Artikelname: HELB Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324648
Hersteller Artikelnummer: orb324648
Alternativnummer: BYT-ORB324648-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HELB
Konjugation: Unconjugated
Alternative Synonym: anti hDHB antibody
Rabbit polyclonal antibody to HELB
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 120kDa
NCBI: 387467
UniProt: Q8NG08
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI
Target-Kategorie: HELB
WB Suggested Anti-HELB Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.