GJD3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324655
| Artikelname: |
GJD3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324655 |
| Hersteller Artikelnummer: |
orb324655 |
| Alternativnummer: |
BYT-ORB324655-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti CX31.9 antibody, anti Cx30.2 antibody, anti GJA11 antibody, anti GJC1 antibody |
| Rabbit polyclonal antibody to GJD3 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
32kDa |
| NCBI: |
689343 |
| UniProt: |
Q8N144 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: GLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPP |
| Target-Kategorie: |
GJD3 |
![]()
|
WB Suggested Anti-GJD3 Antibody, Titration: 1.0 ug/mL, Positive Control: 293T Whole Cell. |
