Prrxl1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324662
Artikelname: Prrxl1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324662
Hersteller Artikelnummer: orb324662
Alternativnummer: BYT-ORB324662-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Prrxl1
Konjugation: Unconjugated
Alternative Synonym: anti Drg11 antibody, anti Drgx antibody, anti Prrxl1 antibody
Rabbit polyclonal antibody to Drgx
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 28kDa
NCBI: 665710
UniProt: Q62798
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: MFYFHCPPQLEGTAPFGNHSTGDFDDGFLRRKQRRNRTTFALQQLEALEA
Target-Kategorie: Drgx
Sample Type: Rat Liver lysates, Antibody Dilution: 1.0 ug/mL.