Zfy1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324676
| Artikelname: |
Zfy1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324676 |
| Hersteller Artikelnummer: |
orb324676 |
| Alternativnummer: |
BYT-ORB324676-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Zfy1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Zfy-1 antibody |
| Rabbit polyclonal antibody to Zfy1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
88kDa |
| NCBI: |
033596 |
| UniProt: |
P10925 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: VDELGETIHAVESETKNGNEAEVTDQSTSIRVPRVNIYMSASDSQKEEED |
| Target-Kategorie: |
Zfy1 |
![]()
|
WB Suggested Anti-Zfy1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Mouse Thymus. |
