Fkhl18 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324677
| Artikelname: |
Fkhl18 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324677 |
| Hersteller Artikelnummer: |
orb324677 |
| Alternativnummer: |
BYT-ORB324677-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the c terminal region of mouse Fkhl18 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti FREAC10 antibody, anti Fkh3 antibody, anti Foxs1 antibody, anti Fkhl18 antibody |
| Rabbit polyclonal antibody to Foxs1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
35 |
| NCBI: |
034356 |
| UniProt: |
Q61574 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MQTLNFCMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVA |
| Target-Kategorie: |
Foxs1 |
![]()
|
WB Suggested Anti-Fkhl18 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Brain. |
