Zkscan14 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324686
| Artikelname: |
Zkscan14 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324686 |
| Hersteller Artikelnummer: |
orb324686 |
| Alternativnummer: |
BYT-ORB324686-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti 2310046C23Rik antibody, anti 2810437E14Rik antibody, anti MGC117641 antibody, anti Zfp99 antibody, anti Znf394 antibody |
| Rabbit polyclonal antibody to Zkscan14 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
59kDa |
| NCBI: |
075811 |
| UniProt: |
Q9Z1D9 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: SVKPHSSVDSAVGLLETQRQFQEDKPYKCDSCEKGFRQRSDLFKHQRIHT |
| Target-Kategorie: |
Zkscan14 |
![]()
|
WB Suggested Anti-Zkscan14 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Mouse Kidney. |
