Hsfy2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324693
| Artikelname: |
Hsfy2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324693 |
| Hersteller Artikelnummer: |
orb324693 |
| Alternativnummer: |
BYT-ORB324693-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hsfy2 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti 4933413G11Rik antibody, anti Hspy2l antibody |
| Rabbit polyclonal antibody to Hsfy2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
44kDa |
| NCBI: |
081937 |
| UniProt: |
Q80Y37 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: SLGVAVQTSERNLLSSSSISNVYLRQKPSLAQGGSDTMDVIRSDFSLATP |
| Target-Kategorie: |
Hsfy2 |
![]()
|
Sample Type: Mouse Brain lysates, Antibody Dilution: 1.0 ug/mL. |
