HSFY2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324694
Artikelname: HSFY2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324694
Hersteller Artikelnummer: orb324694
Alternativnummer: BYT-ORB324694-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: Unconjugated
Alternative Synonym: anti Hspy2l antibody, anti 4933413G11Rik antibody
Rabbit polyclonal antibody to HSFY2
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 43kDa
NCBI: 081937
UniProt: Q80Y37
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EMQGEPSFQPGFPHFSSSSSTYSDSKAKGEPELPIHKERVASTTLASTSN
Target-Kategorie: HSFY2
WB Suggested Anti-HSFY2 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:12500, Positive Control: NIH/3T3 cell lysate.