Jundm2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324698
Artikelname: Jundm2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324698
Hersteller Artikelnummer: orb324698
Alternativnummer: BYT-ORB324698-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of mouse Jundm2
Konjugation: Unconjugated
Alternative Synonym: anti Jdp2 antibody, anti Jundp2 antibody, anti TIF antibody, anti Jundm2 antibody
Rabbit polyclonal antibody to Jdp2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 19kDa
NCBI: 112149
UniProt: P97875
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK
Target-Kategorie: Jdp2
WB Suggested Anti-Jundm2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Heart.