Tcfap4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324699
| Artikelname: |
Tcfap4 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324699 |
| Hersteller Artikelnummer: |
orb324699 |
| Alternativnummer: |
BYT-ORB324699-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Tcfap4 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti AI642933 antibody, anti AP-4 antibody, anti D930048N17Rik antibody, anti Tfap4 antibody, anti Tcfap4 antibody, anti bHLHc41 antibody |
| Rabbit polyclonal antibody to Tfap4 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
39kDa |
| NCBI: |
112459 |
| UniProt: |
Q9JIZ5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPT |
| Target-Kategorie: |
Tfap4 |
![]()
|
WB Suggested Anti-Tcfap4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Mouse Thymus. |
