Tgifx1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324709
| Artikelname: |
Tgifx1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324709 |
| Hersteller Artikelnummer: |
orb324709 |
| Alternativnummer: |
BYT-ORB324709-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti MGC130458 antibody, anti Tex1 antibody, anti Tgifx1 antibody, anti Tgif2lx antibody, anti OTTMUSG00000018465 antibody |
| Rabbit polyclonal antibody to Tgif2lx1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
27kDa |
| NCBI: |
694749 |
| UniProt: |
Q8K5B9 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: RYKPYSLSHEGQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSE |
| Target-Kategorie: |
Tgif2lx1 |
![]()
|
WB Suggested Anti-Tgifx1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Muscle. |
