C330003B14RIK Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324718
| Artikelname: |
C330003B14RIK Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324718 |
| Hersteller Artikelnummer: |
orb324718 |
| Alternativnummer: |
BYT-ORB324718-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse C330003B14RIK |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Eso-1 antibody, anti C80129 antibody, anti AU019881 antibody, anti AU023336 antibody, anti C330003B14Rik antibody |
| Rabbit polyclonal antibody to Cphx1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
1.0 mg/ml |
| Molekulargewicht: |
20kDa |
| NCBI: |
780551 |
| UniProt: |
Q8BX39 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MLSKNFPGAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAP |
| Target-Kategorie: |
Cphx1 |
![]()
|
WB Suggested Anti-C330003B14RIK Antibody Titration: 5.0 ug/mL, Positive Control: SP2/0 cell lysate. |
