Rbfox2 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: Rbfox2 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324719
• Hersteller Artikelnummer: orb324719
• Alternativnummer: BYT-ORB324719-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rbfox2
• Konjugation: Unconjugated
• Alternative Synonym: anti 2810460A15Rik antibody, anti AA407676 antibody, anti AI118529 antibody, anti Fbm2 antibody, anti Fxh antibody, anti Hrnbp2 antibody, anti Rbm9 antibody

Produktbeschreibung

Rabbit polyclonal antibody to Rbfox2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 47kDa
• NCBI: 001104297
• UniProt: Q8BP71
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE
• Target-Kategorie: Rbfox2

Bilder

Sample Type: NIH-3T3 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.