RHOX11 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324725
| Artikelname: |
RHOX11 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324725 |
| Hersteller Artikelnummer: |
orb324725 |
| Alternativnummer: |
BYT-ORB324725-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse RHOX11 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Gm39 antibody, anti BC049711 antibody |
| Rabbit polyclonal antibody to RHOX11 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
23kDa |
| NCBI: |
941000 |
| UniProt: |
Q810N8 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: VMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPGQLWELQAVFV |
| Target-Kategorie: |
RHOX11 |
![]()
|
WB Suggested Anti-RHOX11 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate. |
