MYCLP1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324739
| Artikelname: |
MYCLP1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324739 |
| Hersteller Artikelnummer: |
orb324739 |
| Alternativnummer: |
BYT-ORB324739-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of human MYCLP1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti MYCLP1 antibody, anti MYCL1P1 antibody, anti MYCL2 antibody, anti antibody |
| Rabbit polyclonal antibody to MYCLP1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
39kDa |
| UniProt: |
P12525 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LLAVGAPSGYSPKEFATPDYTPELEAGNLAPIFPCLLGEPKIQACSRSES |
| Target-Kategorie: |
MYCLP1 |
![]()
|
Sample Type: HepG2 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL. |
