Prrxl1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324743
| Artikelname: |
Prrxl1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324743 |
| Hersteller Artikelnummer: |
orb324743 |
| Alternativnummer: |
BYT-ORB324743-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the c terminal region of mouse Prrxl1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Drg11 antibody, anti Drgx antibody |
| Rabbit polyclonal antibody to Prrxl1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
25kDa |
| NCBI: |
001001796 |
| UniProt: |
Q8BYH0 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: PSCLPGTLLNTATYAQALSHVASLKDHFRAMLCSGSFGFRGEQTQQRALT |
| Target-Kategorie: |
Prrxl1 |
![]()
|
WB Suggested Anti-Prrxl1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Mouse Muscle. |
