Hpcal1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324751
| Artikelname: |
Hpcal1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324751 |
| Hersteller Artikelnummer: |
orb324751 |
| Alternativnummer: |
BYT-ORB324751-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti NVP-3 antibody, anti Nvp3 antibody, anti VILIP3 antibody, anti Vnsl3 antibody, anti Vsnl3 antibody |
| Rabbit polyclonal antibody to Hpcal1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
22kDa |
| NCBI: |
057886 |
| UniProt: |
P62748 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: FSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFR |
| Target-Kategorie: |
Hpcal1 |
![]()
|
WB Suggested Anti-Hpcal1 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Heart. |
