FOXG1B Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: FOXG1B Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324763
• Hersteller Artikelnummer: orb324763
• Alternativnummer: BYT-ORB324763-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FOXG1B
• Konjugation: Unconjugated
• Alternative Synonym: anti BF1 antibody, anti BF2 antibody, anti QIN antibody, anti FKH2 antibody, anti HBF2 antibody, anti HFK1 antibody, anti HFK2 antibody, anti HFK3 antibody, anti KHL2 antibody, anti FHKL3 antibody, anti FKHL1 antibody, anti FKHL2 antibody, anti FKHL3 antibody, anti FKHL4 antibody, anti HBF-1 antibody, anti HBF-2 antibody, anti HBF-3 antibody, anti FOXG1A antibody, anti FOXG1B antibody, anti FOXG1C antibody, anti HBF-G2 antibody

Produktbeschreibung

Rabbit polyclonal antibody to FOXG1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 52kDa
• NCBI: 005240
• UniProt: Q86XT7
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: STSMSARATSSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQ
• Target-Kategorie: FOXG1

Bilder

WB Suggested Anti-FOXG1B Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293T.