RTRAF Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324786
| Artikelname: |
RTRAF Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324786 |
| Hersteller Artikelnummer: |
orb324786 |
| Alternativnummer: |
BYT-ORB324786-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf166 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti CGI-99 antibody, anti CGI99 antibody, anti CLE antibody, anti CLE7 antibody, anti LCRP369 antibody, anti RLLM1 antibody |
| Rabbit polyclonal antibody to C14orf166 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
28kDa |
| NCBI: |
057123 |
| UniProt: |
Q9Y224 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRN |
| Target-Kategorie: |
RTRAF |
|
WB Suggested Anti-C14orf166 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human heart. |