BTBD2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324791
Artikelname: BTBD2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324791
Hersteller Artikelnummer: orb324791
Alternativnummer: BYT-ORB324791-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human BTBD2
Konjugation: Unconjugated
Rabbit polyclonal antibody to BTBD2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 22kDa
NCBI: 060267
UniProt: Q9BX70
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: NYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCYAAGNNNGTSV
Target-Kategorie: BTBD2
Sample Type: Esophagus Tumor lysates, Antibody Dilution: 1.0 ug/mL.