TULP4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324795
| Artikelname: |
TULP4 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324795 |
| Hersteller Artikelnummer: |
orb324795 |
| Alternativnummer: |
BYT-ORB324795-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human TULP4 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti KIAA1397 antibody, anti TUSP antibody, anti RP3-442A17.1 antibody |
| Rabbit polyclonal antibody to TULP4 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
76kDa |
| NCBI: |
001007467 |
| UniProt: |
Q5T3M2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGN |
| Target-Kategorie: |
TULP4 |
![]()
|
WB Suggested Anti-TULP4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. |
