ZNF335 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324805
Artikelname: ZNF335 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324805
Hersteller Artikelnummer: orb324805
Alternativnummer: BYT-ORB324805-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF335
Konjugation: Unconjugated
Alternative Synonym: anti NIF1 antibody, anti NIF2 antibody, anti NIF-1 antibody
Rabbit polyclonal antibody to ZNF335
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 145kDa
NCBI: 071378
UniProt: Q9H4Z2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EAAAHSAVTAVADAAMAQAQGLFGTDETVPEHIQQLQHQGIEYDVITLAD
Target-Kategorie: ZNF335
WB Suggested Anti-ZNF335 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human brain.