ZNF419A Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324808
Artikelname: ZNF419A Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324808
Hersteller Artikelnummer: orb324808
Alternativnummer: BYT-ORB324808-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF419A
Konjugation: Unconjugated
Alternative Synonym: anti ZNF419A antibody
Rabbit polyclonal antibody to ZNF419
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 59kDa
NCBI: 078967
UniProt: Q96HQ0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GRLFRENSSLVKHQRVHTGAKPYECRECGKFFRHNSSLFKHRRIHTGEMQ
Target-Kategorie: ZNF419
WB Suggested Anti-ZNF419A Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.