FBXL10 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324814
| Artikelname: |
FBXL10 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324814 |
| Hersteller Artikelnummer: |
orb324814 |
| Alternativnummer: |
BYT-ORB324814-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human FBXL10 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti CXXC2 antibody, anti Fbl10 antibody, anti JHDM1B antibody, anti KDM2B antibody, anti PCCX2 antibody, anti FBXL10 antibody |
| Rabbit polyclonal antibody to KDM2B |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
152kDa |
| NCBI: |
115979 |
| UniProt: |
Q8NHM5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKL |
| Target-Kategorie: |
KDM2B |
![]()
|
WB Suggested Anti-FBXL10 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Stomach. |
