FBXL10 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324814
Artikelname: FBXL10 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324814
Hersteller Artikelnummer: orb324814
Alternativnummer: BYT-ORB324814-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXL10
Konjugation: Unconjugated
Alternative Synonym: anti CXXC2 antibody, anti Fbl10 antibody, anti JHDM1B antibody, anti KDM2B antibody, anti PCCX2 antibody, anti FBXL10 antibody
Rabbit polyclonal antibody to KDM2B
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 152kDa
NCBI: 115979
UniProt: Q8NHM5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKL
Target-Kategorie: KDM2B
WB Suggested Anti-FBXL10 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Stomach.