ZNF545 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324817
Artikelname: ZNF545 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324817
Hersteller Artikelnummer: orb324817
Alternativnummer: BYT-ORB324817-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF545
Konjugation: Unconjugated
Alternative Synonym: anti ZNF545 antibody
Rabbit polyclonal antibody to ZFP82
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 63kDa
NCBI: 597723
UniProt: Q8N141
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: CRKAFRLNSSLIQHLRIHSGEKPYECKECKKAFRQHSHLTHHLKIHNVKI
Target-Kategorie: ZFP82
WB Suggested Anti-ZNF545 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Transfected 293T.