ZNF342 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324820
Artikelname: ZNF342 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324820
Hersteller Artikelnummer: orb324820
Alternativnummer: BYT-ORB324820-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF342
Konjugation: Unconjugated
Alternative Synonym: anti ZNF296 antibody, anti ZFP296 antibody, anti ZNF342 antibody
Rabbit polyclonal antibody to ZNF296
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 51kDa
NCBI: 660331
UniProt: Q8WUU4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: KLLRHAQWDHGLSIYQTESEAPEAPLLGLAEVAAAVSAVVGPAAEAKSPR
Target-Kategorie: ZNF296
WB Suggested Anti-ZNF342 Antibody Titration: 0.2-1 ug/mL, Positive Control: Transfected 293T.