MGC46336 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324830
Artikelname: MGC46336 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324830
Hersteller Artikelnummer: orb324830
Alternativnummer: BYT-ORB324830-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC46336
Konjugation: Unconjugated
Rabbit polyclonal antibody to ZNF843
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 37kDa
NCBI: 290712
UniProt: Q8N446
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GFTQSASLLQHWRVHSDWRETLSLSPVRQDLLWPLQPHQAPASPLGRSHS
Target-Kategorie: ZNF843
WB Suggested Anti-MGC46336 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.