PABPC1L2A Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324845
| Artikelname: |
PABPC1L2A Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324845 |
| Hersteller Artikelnummer: |
orb324845 |
| Alternativnummer: |
BYT-ORB324845-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human PABPC1L2A |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti RBM32A antibody, anti PABPC1L2B antibody, anti RP11-493K23.3 antibody |
| Rabbit polyclonal antibody to PABPC1L2A |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
23kDa |
| NCBI: |
001012995 |
| UniProt: |
Q5JQF8 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL |
| Target-Kategorie: |
PABPC1L2A |
![]()
|
WB Suggested Anti-PABPC1L2A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate. |
