LGTN Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324889
| Artikelname: |
LGTN Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324889 |
| Hersteller Artikelnummer: |
orb324889 |
| Alternativnummer: |
BYT-ORB324889-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human LGTN |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti HCA56 antibody, anti LGTN antibody |
| Rabbit polyclonal antibody to EIF2D |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
65kDa |
| NCBI: |
008824 |
| UniProt: |
P41214 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ |
| Target-Kategorie: |
EIF2D |
![]()
|
WB Suggested Anti-LGTN Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293T. |
