Gm14277 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324890
| Artikelname: |
Gm14277 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324890 |
| Hersteller Artikelnummer: |
orb324890 |
| Alternativnummer: |
BYT-ORB324890-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti OTTMUSG00000016169 antibody |
| Rabbit polyclonal antibody to Gm14277 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
13kDa |
| NCBI: |
001481216 |
| UniProt: |
P62315 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: VRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPV |
| Target-Kategorie: |
Gm14277 |
![]()
|
WB Suggested Anti-Gm14277 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver. |
