EXOSC3 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324905
Artikelname: EXOSC3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324905
Hersteller Artikelnummer: orb324905
Alternativnummer: BYT-ORB324905-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EXOSC3
Konjugation: Unconjugated
Alternative Synonym: anti PCH1B antibody, anti RP11-3J10.8 antibody, anti RRP40 antibody, anti Rrp40p antibody, anti bA3J10.7 antibody, anti hRrp-40 antibody, anti p10 antibody
Rabbit polyclonal antibody to EXOSC3
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 30kDa
NCBI: 057126
UniProt: Q9NQT5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFK
Target-Kategorie: EXOSC3
Sample Type: Esophagus Tumor lysates, Antibody Dilution: 1.0 ug/mL.